TLN1 monoclonal antibody (M80A), clone 2B11 View larger

TLN1 monoclonal antibody (M80A), clone 2B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLN1 monoclonal antibody (M80A), clone 2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TLN1 monoclonal antibody (M80A), clone 2B11

Brand: Abnova
Reference: H00007094-M80A
Product name: TLN1 monoclonal antibody (M80A), clone 2B11
Product description: Mouse monoclonal antibody raised against a partial recombinant TLN1.
Clone: 2B11
Isotype: IgM Kappa
Gene id: 7094
Gene name: TLN1
Gene alias: ILWEQ|KIAA1027|TLN
Gene description: talin 1
Genbank accession: BC042923
Immunogen: TLN1 (AAH42923.1, 86 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKK
Protein accession: AAH42923.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TLN1 monoclonal antibody (M80A), clone 2B11 now

Add to cart