| Brand:  | Abnova | 
| Reference:  | H00007094-M19 | 
| Product name:  | TLN1 monoclonal antibody (M19), clone 1A5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TLN1. | 
| Clone:  | 1A5 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 7094 | 
| Gene name:  | TLN1 | 
| Gene alias:  | ILWEQ|KIAA1027|TLN | 
| Gene description:  | talin 1 | 
| Genbank accession:  | BC042923 | 
| Immunogen:  | TLN1 (AAH42923, 1324 a.a. ~ 1424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD | 
| Protein accession:  | AAH42923 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to TLN1 on HeLa cell . [antibody concentration 10 ug/ml] | 
| Applications:  | IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |