Cart 47 Product Products 17 649,40 € (empty)
No products
To be determined Shipping
17 649,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 47 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 649,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 649,40 €
Data sheet of TLN1 monoclonal antibody (M13), clone 8B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TLN1 monoclonal antibody (M13), clone 8B11
| Brand: | Abnova |
| Reference: | H00007094-M13 |
| Product name: | TLN1 monoclonal antibody (M13), clone 8B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLN1. |
| Clone: | 8B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7094 |
| Gene name: | TLN1 |
| Gene alias: | ILWEQ|KIAA1027|TLN |
| Gene description: | talin 1 |
| Genbank accession: | BC042923 |
| Immunogen: | TLN1 (AAH42923, 1324 a.a. ~ 1424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD |
| Protein accession: | AAH42923 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |