TLN1 monoclonal antibody (M02), clone 5D1 View larger

TLN1 monoclonal antibody (M02), clone 5D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLN1 monoclonal antibody (M02), clone 5D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TLN1 monoclonal antibody (M02), clone 5D1

Brand: Abnova
Reference: H00007094-M02
Product name: TLN1 monoclonal antibody (M02), clone 5D1
Product description: Mouse monoclonal antibody raised against a partial recombinant TLN1.
Clone: 5D1
Isotype: IgG3 Kappa
Gene id: 7094
Gene name: TLN1
Gene alias: ILWEQ|KIAA1027|TLN
Gene description: talin 1
Genbank accession: NM_006289
Immunogen: TLN1 (NP_006280, 1052 a.a. ~ 1149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQA
Protein accession: NP_006280
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007094-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLN1 monoclonal antibody (M02), clone 5D1 now

Add to cart