Brand: | Abnova |
Reference: | H00007080-M02 |
Product name: | TITF1 monoclonal antibody (M02), clone 1G2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TITF1. |
Clone: | 1G2 |
Isotype: | IgG2b Kappa |
Gene id: | 7080 |
Gene name: | NKX2-1 |
Gene alias: | BCH|BHC|NK-2|NKX2.1|NKX2A|TEBP|TITF1|TTF-1|TTF1 |
Gene description: | NK2 homeobox 1 |
Genbank accession: | NM_003317 |
Immunogen: | TITF1 (NP_003308, 77 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPS |
Protein accession: | NP_003308 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |