Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of TIMP3 monoclonal antibody (M01), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about TIMP3 monoclonal antibody (M01), clone 1D8
| Brand: | Abnova |
| Reference: | H00007078-M01 |
| Product name: | TIMP3 monoclonal antibody (M01), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TIMP3. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7078 |
| Gene name: | TIMP3 |
| Gene alias: | HSMRK222|K222|K222TA2|SFD |
| Gene description: | TIMP metallopeptidase inhibitor 3 |
| Genbank accession: | BC014277 |
| Immunogen: | TIMP3 (AAH14277, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
| Protein accession: | AAH14277 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TIMP3 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |