TIMP2 monoclonal antibody (M04), clone 5B11 View larger

TIMP2 monoclonal antibody (M04), clone 5B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMP2 monoclonal antibody (M04), clone 5B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about TIMP2 monoclonal antibody (M04), clone 5B11

Brand: Abnova
Reference: H00007077-M04
Product name: TIMP2 monoclonal antibody (M04), clone 5B11
Product description: Mouse monoclonal antibody raised against a full-length recombinant TIMP2.
Clone: 5B11
Isotype: IgG1 Kappa
Gene id: 7077
Gene name: TIMP2
Gene alias: CSC-21K
Gene description: TIMP metallopeptidase inhibitor 2
Genbank accession: BC052605
Immunogen: TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Protein accession: AAH52605
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007077-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007077-M04-1-1-1.jpg
Application image note: TIMP2 monoclonal antibody (M04), clone 5B11 Western Blot analysis of TIMP2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TIMP2 monoclonal antibody (M04), clone 5B11 now

Add to cart