Brand: | Abnova |
Reference: | H00007077-M03 |
Product name: | TIMP2 monoclonal antibody (M03), clone 1C3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TIMP2. |
Clone: | 1C3 |
Isotype: | IgG1 Kappa |
Gene id: | 7077 |
Gene name: | TIMP2 |
Gene alias: | CSC-21K |
Gene description: | TIMP metallopeptidase inhibitor 2 |
Genbank accession: | BC052605 |
Immunogen: | TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
Protein accession: | AAH52605 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TIMP2 monoclonal antibody (M03), clone 1C3 Western Blot analysis of TIMP2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |