Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of TIMP2 monoclonal antibody (M02J), clone 4F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about TIMP2 monoclonal antibody (M02J), clone 4F5
| Reference: | H00007077-M02J |
| Product name: | TIMP2 monoclonal antibody (M02J), clone 4F5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TIMP2. |
| Clone: | 4F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7077 |
| Gene name: | TIMP2 |
| Gene alias: | CSC-21K |
| Gene description: | TIMP metallopeptidase inhibitor 2 |
| Genbank accession: | BC052605 |
| Immunogen: | TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
| Protein accession: | AAH52605 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |