TIMP2 monoclonal antibody (M02C), clone 4F5 View larger

TIMP2 monoclonal antibody (M02C), clone 4F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMP2 monoclonal antibody (M02C), clone 4F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TIMP2 monoclonal antibody (M02C), clone 4F5

Brand: Abnova
Reference: H00007077-M02C
Product name: TIMP2 monoclonal antibody (M02C), clone 4F5
Product description: Mouse monoclonal antibody raised against a full-length recombinant TIMP2.
Clone: 4F5
Isotype: IgG2a Kappa
Gene id: 7077
Gene name: TIMP2
Gene alias: CSC-21K
Gene description: TIMP metallopeptidase inhibitor 2
Genbank accession: BC052605
Immunogen: TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Protein accession: AAH52605
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007077-M02C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TIMP2 monoclonal antibody (M02C), clone 4F5 now

Add to cart