TIMP1 monoclonal antibody (M01), clone 4D12 View larger

TIMP1 monoclonal antibody (M01), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMP1 monoclonal antibody (M01), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr,IP

More info about TIMP1 monoclonal antibody (M01), clone 4D12

Brand: Abnova
Reference: H00007076-M01
Product name: TIMP1 monoclonal antibody (M01), clone 4D12
Product description: Mouse monoclonal antibody raised against a full length recombinant TIMP1.
Clone: 4D12
Isotype: IgG1 Kappa
Gene id: 7076
Gene name: TIMP1
Gene alias: CLGI|EPA|EPO|FLJ90373|HCI|TIMP
Gene description: TIMP metallopeptidase inhibitor 1
Genbank accession: BC007097
Immunogen: TIMP1 (AAH07097, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCL
Protein accession: AAH07097
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007076-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TIMP1 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy TIMP1 monoclonal antibody (M01), clone 4D12 now

Add to cart