TIE1 monoclonal antibody (M20), clone 1G10 View larger

TIE1 monoclonal antibody (M20), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIE1 monoclonal antibody (M20), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TIE1 monoclonal antibody (M20), clone 1G10

Brand: Abnova
Reference: H00007075-M20
Product name: TIE1 monoclonal antibody (M20), clone 1G10
Product description: Mouse monoclonal antibody raised against a full length recombinant TIE1.
Clone: 1G10
Isotype: IgG2a Kappa
Gene id: 7075
Gene name: TIE1
Gene alias: JTK14|TIE
Gene description: tyrosine kinase with immunoglobulin-like and EGF-like domains 1
Genbank accession: NM_005424
Immunogen: TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG*
Protein accession: NP_005415
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007075-M20-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TIE1 monoclonal antibody (M20), clone 1G10 now

Add to cart