| Brand: | Abnova |
| Reference: | H00007075-M20 |
| Product name: | TIE1 monoclonal antibody (M20), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TIE1. |
| Clone: | 1G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7075 |
| Gene name: | TIE1 |
| Gene alias: | JTK14|TIE |
| Gene description: | tyrosine kinase with immunoglobulin-like and EGF-like domains 1 |
| Genbank accession: | NM_005424 |
| Immunogen: | TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG* |
| Protein accession: | NP_005415 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |