Brand: | Abnova |
Reference: | H00007075-M18 |
Product name: | TIE1 monoclonal antibody (M18), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TIE1. |
Clone: | 3E9 |
Isotype: | IgG2b Kappa |
Gene id: | 7075 |
Gene name: | TIE1 |
Gene alias: | JTK14|TIE |
Gene description: | tyrosine kinase with immunoglobulin-like and EGF-like domains 1 |
Genbank accession: | NM_005424 |
Immunogen: | TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG* |
Protein accession: | NP_005415 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TIE1 monoclonal antibody (M18), clone 3E9. Western Blot analysis of TIE1 expression in Hela S3 NE. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |