| Brand: | Abnova |
| Reference: | H00007071-M62 |
| Product name: | KLF10 monoclonal antibody (M62), clone 5G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF10. |
| Clone: | 5G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7071 |
| Gene name: | KLF10 |
| Gene alias: | EGRA|TIEG|TIEG1 |
| Gene description: | Kruppel-like factor 10 |
| Genbank accession: | BC011538.1 |
| Immunogen: | KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD |
| Protein accession: | AAH11538.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |