KLF10 monoclonal antibody (M56), clone 4D12 View larger

KLF10 monoclonal antibody (M56), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLF10 monoclonal antibody (M56), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about KLF10 monoclonal antibody (M56), clone 4D12

Brand: Abnova
Reference: H00007071-M56
Product name: KLF10 monoclonal antibody (M56), clone 4D12
Product description: Mouse monoclonal antibody raised against a partial recombinant KLF10.
Clone: 4D12
Isotype: IgG2b Kappa
Gene id: 7071
Gene name: KLF10
Gene alias: EGRA|TIEG|TIEG1
Gene description: Kruppel-like factor 10
Genbank accession: BC011538.1
Immunogen: KLF10 (AAH11538.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS
Protein accession: AAH11538.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007071-M56-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KLF10 monoclonal antibody (M56), clone 4D12 now

Add to cart