View larger

KLF10 monoclonal antibody (M52), clone 3H3

Reference:

Condition: New product

Data sheet of KLF10 monoclonal antibody (M52), clone 3H3

Brand:	Abnova
Reference:	H00007071-M52
Product name:	KLF10 monoclonal antibody (M52), clone 3H3
Product description:	Mouse monoclonal antibody raised against a partial recombinant KLF10.
Clone:	3H3
Isotype:	IgG2a Kappa
Gene id:	7071
Gene name:	KLF10
Gene alias:	EGRA\|TIEG\|TIEG1
Gene description:	Kruppel-like factor 10
Genbank accession:	BC011538.1
Immunogen:	KLF10 (AAH11538.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS
Protein accession:	AAH11538.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.73 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice