No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007071-M46 |
Product name: | KLF10 monoclonal antibody (M46), clone 2H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF10. |
Clone: | 2H5 |
Isotype: | IgG2a Kappa |
Gene id: | 7071 |
Gene name: | KLF10 |
Gene alias: | EGRA|TIEG|TIEG1 |
Gene description: | Kruppel-like factor 10 |
Genbank accession: | BC011538.1 |
Immunogen: | KLF10 (AAH11538.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS |
Protein accession: | AAH11538.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |