Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of THY1 monoclonal antibody (M01), clone 3F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about THY1 monoclonal antibody (M01), clone 3F9
| Brand: | Abnova |
| Reference: | H00007070-M01 |
| Product name: | THY1 monoclonal antibody (M01), clone 3F9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant THY1. |
| Clone: | 3F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7070 |
| Gene name: | THY1 |
| Gene alias: | CD90|FLJ33325 |
| Gene description: | Thy-1 cell surface antigen |
| Genbank accession: | BC005175 |
| Immunogen: | THY1 (AAH05175, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL |
| Protein accession: | AAH05175 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | THY1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of THY1 expression in IMR-32. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | CD90 is identified as a marker for cancer stem cells in primary high-grade gliomas using tissue microarrays.He J, Liu Y, Zhu T, Zhu J, Dimeco F, Vescovi AL, Heth JA, Muraszko KM, Fan X, Lubman DM. Mol Cell Proteomics. 2012 Jun;11(6):M111.010744. Epub 2011 Dec 27. |