| Brand: | Abnova |
| Reference: | H00007067-A01 |
| Product name: | THRA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant THRA. |
| Gene id: | 7067 |
| Gene name: | THRA |
| Gene alias: | AR7|EAR7|ERB-T-1|ERBA|ERBA1|MGC000261|MGC43240|NR1A1|THRA1|THRA2|c-ERBA-1 |
| Gene description: | thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) |
| Genbank accession: | BC002728 |
| Immunogen: | THRA (AAH02728, 87 a.a. ~ 178 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST |
| Protein accession: | AAH02728 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | THRA polyclonal antibody (A01). Western Blot analysis of THRA expression in PC-12. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |