Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGM2 monoclonal antibody (M10), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TGM2 monoclonal antibody (M10), clone 2F4
| Brand: | Abnova |
| Reference: | H00007052-M10 |
| Product name: | TGM2 monoclonal antibody (M10), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TGM2. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7052 |
| Gene name: | TGM2 |
| Gene alias: | G-ALPHA-h|GNAH|TG2|TGC |
| Gene description: | transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) |
| Genbank accession: | BC003551 |
| Immunogen: | TGM2 (AAH03551, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE |
| Protein accession: | AAH03551 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TGM2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach.Xue H, Lu B, Zhang J, Wu M, Huang Q, Wu Q, Sheng H, Wu D, Hu J, Lai M. J Proteome Res. 2010 Jan;9(1):545-55. |