Cart 7 Product Products 2 767,00 € (empty)
-
-
-
1 x Granulysin544,00 € -
-
-
-
No products
To be determined Shipping
2 767,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 767,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 767,00 €
Data sheet of TGM2 monoclonal antibody (M06), clone 1A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about TGM2 monoclonal antibody (M06), clone 1A6
| Brand: | Abnova |
| Reference: | H00007052-M06 |
| Product name: | TGM2 monoclonal antibody (M06), clone 1A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TGM2. |
| Clone: | 1A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7052 |
| Gene name: | TGM2 |
| Gene alias: | G-ALPHA-h|GNAH|TG2|TGC |
| Gene description: | transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) |
| Genbank accession: | BC003551 |
| Immunogen: | TGM2 (AAH03551, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE |
| Protein accession: | AAH03551 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TGM2 monoclonal antibody (M06), clone 1A6. Western Blot analysis of TGM2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |