TGM2 monoclonal antibody (M02), clone 1A8 View larger

TGM2 monoclonal antibody (M02), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGM2 monoclonal antibody (M02), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TGM2 monoclonal antibody (M02), clone 1A8

Brand: Abnova
Reference: H00007052-M02
Product name: TGM2 monoclonal antibody (M02), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant TGM2.
Clone: 1A8
Isotype: IgG2b Kappa
Gene id: 7052
Gene name: TGM2
Gene alias: G-ALPHA-h|GNAH|TG2|TGC
Gene description: transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
Genbank accession: BC003551
Immunogen: TGM2 (AAH03551, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
Protein accession: AAH03551
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007052-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007052-M02-1-9-1.jpg
Application image note: TGM2 monoclonal antibody (M02), clone 1A8. Western Blot analysis of TGM2 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TGM2 monoclonal antibody (M02), clone 1A8 now

Add to cart