Brand: | Abnova |
Reference: | H00007050-M01 |
Product name: | TGIF monoclonal antibody (M01), clone 1D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TGIF. |
Clone: | 1D12 |
Isotype: | IgG1 Kappa |
Gene id: | 7050 |
Gene name: | TGIF1 |
Gene alias: | HPE4|MGC39747|MGC5066|TGIF |
Gene description: | TGFB-induced factor homeobox 1 |
Genbank accession: | NM_003244 |
Immunogen: | TGIF (NP_003235, 163 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA |
Protein accession: | NP_003235 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TGIF is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |