TGIF monoclonal antibody (M01), clone 1D12 View larger

TGIF monoclonal antibody (M01), clone 1D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGIF monoclonal antibody (M01), clone 1D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TGIF monoclonal antibody (M01), clone 1D12

Brand: Abnova
Reference: H00007050-M01
Product name: TGIF monoclonal antibody (M01), clone 1D12
Product description: Mouse monoclonal antibody raised against a partial recombinant TGIF.
Clone: 1D12
Isotype: IgG1 Kappa
Gene id: 7050
Gene name: TGIF1
Gene alias: HPE4|MGC39747|MGC5066|TGIF
Gene description: TGFB-induced factor homeobox 1
Genbank accession: NM_003244
Immunogen: TGIF (NP_003235, 163 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
Protein accession: NP_003235
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007050-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TGIF is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TGIF monoclonal antibody (M01), clone 1D12 now

Add to cart