| Brand: | Abnova |
| Reference: | H00007048-A01 |
| Product name: | TGFBR2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TGFBR2. |
| Gene id: | 7048 |
| Gene name: | TGFBR2 |
| Gene alias: | AAT3|FAA3|LDS1B|LDS2B|MFS2|RIIC|TAAD2|TGFR-2|TGFbeta-RII |
| Gene description: | transforming growth factor, beta receptor II (70/80kDa) |
| Genbank accession: | NM_001024847 |
| Immunogen: | TGFBR2 (NP_001020018, 62 a.a. ~ 165 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS |
| Protein accession: | NP_001020018 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | TGFBR2 polyclonal antibody (A01), Lot # 060525JCSI. Western Blot analysis of TGFBR2 expression in Raw 264.7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Halofuginone enhances the radiation sensitivity of human tumor cell lines.Cook JA, Choudhuri R, Degraff W, Gamson J, Mitchell JB. Cancer Lett. 2009 Aug 25. [Epub ahead of print] |