Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGFBI polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TGFBI polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007045-A01 |
| Product name: | TGFBI polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TGFBI. |
| Gene id: | 7045 |
| Gene name: | TGFBI |
| Gene alias: | BIGH3|CDB1|CDG2|CDGG1|CSD|CSD1|CSD2|CSD3|EBMD|LCD1 |
| Gene description: | transforming growth factor, beta-induced, 68kDa |
| Genbank accession: | BC000097 |
| Immunogen: | TGFBI (AAH00097.1, 481 a.a. ~ 580 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AHDKRGRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILVS |
| Protein accession: | AAH00097.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TGFBI polyclonal antibody (A01), Lot # 051003JC01. Western Blot analysis of TGFBI expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Unique TGFBI Protein in Granular Corneal Dystrophy Types 1 and 2.Han YP, Sim AJ, Vora SC, Huang AJ. Curr Eye Res. 2012 Jun 29. |