| Brand: | Abnova |
| Reference: | H00007044-M04 |
| Product name: | LEFTY2 monoclonal antibody (M04), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LEFTY2. |
| Clone: | 1H6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7044 |
| Gene name: | LEFTY2 |
| Gene alias: | EBAF|LEFTA|LEFTYA|MGC46222|TGFB4 |
| Gene description: | left-right determination factor 2 |
| Genbank accession: | NM_003240 |
| Immunogen: | LEFTY2 (NP_003231, 77 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV |
| Protein accession: | NP_003231 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LEFTY2 monoclonal antibody (M04), clone 1H6. Western Blot analysis of LEFTY2 expression in human Skeletal muscle. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |