Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGFB1 monoclonal antibody (M02A), clone 4E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TGFB1 monoclonal antibody (M02A), clone 4E1
| Brand: | Abnova |
| Reference: | H00007040-M02A |
| Product name: | TGFB1 monoclonal antibody (M02A), clone 4E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TGFB1. |
| Clone: | 4E1 |
| Isotype: | IgG |
| Gene id: | 7040 |
| Gene name: | TGFB1 |
| Gene alias: | CED|DPD1|TGFB|TGFbeta |
| Gene description: | transforming growth factor, beta 1 |
| Genbank accession: | NM_000660 |
| Immunogen: | TGFB1 (NP_000651, 279 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Protein accession: | NP_000651 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |