Cart 18 Product Products 5 512,76 € (empty)
-
-
-
-
-
-
-
-
-
-
1 x FDC-SP...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
5 512,76 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 512,76 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 512,76 €
Data sheet of TG monoclonal antibody (M01), clone 1G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about TG monoclonal antibody (M01), clone 1G3
| Brand: | Abnova |
| Reference: | H00007038-M01 |
| Product name: | TG monoclonal antibody (M01), clone 1G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TG. |
| Clone: | 1G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7038 |
| Gene name: | TG |
| Gene alias: | AITD3|TGN |
| Gene description: | thyroglobulin |
| Genbank accession: | NM_003235 |
| Immunogen: | TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK |
| Protein accession: | NP_003226 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TG is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |