TFRC monoclonal antibody (M02), clone 1H5 View larger

TFRC monoclonal antibody (M02), clone 1H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFRC monoclonal antibody (M02), clone 1H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TFRC monoclonal antibody (M02), clone 1H5

Brand: Abnova
Reference: H00007037-M02
Product name: TFRC monoclonal antibody (M02), clone 1H5
Product description: Mouse monoclonal antibody raised against a partial recombinant TFRC.
Clone: 1H5
Isotype: IgG2b Kappa
Gene id: 7037
Gene name: TFRC
Gene alias: CD71|TFR|TFR1|TRFR
Gene description: transferrin receptor (p90, CD71)
Genbank accession: BC001188
Immunogen: TFRC (AAH01188, 68 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY
Protein accession: AAH01188
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007037-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFRC monoclonal antibody (M02), clone 1H5 now

Add to cart