Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TFRC monoclonal antibody (M01A), clone 1E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TFRC monoclonal antibody (M01A), clone 1E6
| Brand: | Abnova |
| Reference: | H00007037-M01A |
| Product name: | TFRC monoclonal antibody (M01A), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TFRC. |
| Clone: | 1E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7037 |
| Gene name: | TFRC |
| Gene alias: | CD71|TFR|TFR1|TRFR |
| Gene description: | transferrin receptor (p90, CD71) |
| Genbank accession: | BC001188 |
| Immunogen: | TFRC (AAH01188, 68 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY |
| Protein accession: | AAH01188 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TFRC monoclonal antibody (M01A), clone 1E6 Western Blot analysis of TFRC expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |