| Brand: | Abnova |
| Reference: | H00007035-M01A |
| Product name: | TFPI monoclonal antibody (M01A), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TFPI. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7035 |
| Gene name: | TFPI |
| Gene alias: | EPI|LACI|TFI|TFPI1 |
| Gene description: | tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) |
| Genbank accession: | BC015514 |
| Immunogen: | TFPI (AAH15514, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC |
| Protein accession: | AAH15514 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |