TFPI polyclonal antibody (A01) View larger

TFPI polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFPI polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TFPI polyclonal antibody (A01)

Brand: Abnova
Reference: H00007035-A01
Product name: TFPI polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TFPI.
Gene id: 7035
Gene name: TFPI
Gene alias: EPI|LACI|TFI|TFPI1
Gene description: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
Genbank accession: BC015514
Immunogen: TFPI (AAH15514, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKSAAHIYQVFLNAFCIHASMFFLGLDSISCLC
Protein accession: AAH15514
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007035-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFPI polyclonal antibody (A01) now

Add to cart