Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 545,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 545,00 €
Data sheet of TFF3 monoclonal antibody (M02A), clone 3G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TFF3 monoclonal antibody (M02A), clone 3G11
| Brand: | Abnova |
| Reference: | H00007033-M02A |
| Product name: | TFF3 monoclonal antibody (M02A), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TFF3. |
| Clone: | 3G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7033 |
| Gene name: | TFF3 |
| Gene alias: | HITF|ITF|TFI|hP1.B |
| Gene description: | trefoil factor 3 (intestinal) |
| Genbank accession: | BC017859 |
| Immunogen: | TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Protein accession: | AAH17859.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |