Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TFF3 monoclonal antibody (M02), clone 3G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about TFF3 monoclonal antibody (M02), clone 3G11
| Brand: | Abnova |
| Reference: | H00007033-M02 |
| Product name: | TFF3 monoclonal antibody (M02), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TFF3. |
| Clone: | 3G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7033 |
| Gene name: | TFF3 |
| Gene alias: | HITF|ITF|TFI|hP1.B |
| Gene description: | trefoil factor 3 (intestinal) |
| Genbank accession: | BC017859 |
| Immunogen: | TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Protein accession: | AAH17859.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TFF3 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification and use of the putative Bacteroides ovatus xylanase promoter for the inducible production of recombinant human proteins.Hamady ZZ, Farrar MD, Whitehead TR, Holland KT, Lodge JP, Carding SR. Microbiology. 2008 Oct;154(Pt 10):3165-74. |