TFDP1 monoclonal antibody (M02), clone 3E4 View larger

TFDP1 monoclonal antibody (M02), clone 3E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFDP1 monoclonal antibody (M02), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TFDP1 monoclonal antibody (M02), clone 3E4

Brand: Abnova
Reference: H00007027-M02
Product name: TFDP1 monoclonal antibody (M02), clone 3E4
Product description: Mouse monoclonal antibody raised against a partial recombinant TFDP1.
Clone: 3E4
Isotype: IgG2a Kappa
Gene id: 7027
Gene name: TFDP1
Gene alias: DP1|DRTF1|Dp-1
Gene description: transcription factor Dp-1
Genbank accession: NM_007111
Immunogen: TFDP1 (NP_009042.1, 112 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ
Protein accession: NP_009042.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007027-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007027-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TFDP1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFDP1 monoclonal antibody (M02), clone 3E4 now

Add to cart