Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR2F2 monoclonal antibody (M15A), clone 2G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about NR2F2 monoclonal antibody (M15A), clone 2G12
| Brand: | Abnova |
| Reference: | H00007026-M15A |
| Product name: | NR2F2 monoclonal antibody (M15A), clone 2G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR2F2. |
| Clone: | 2G12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7026 |
| Gene name: | NR2F2 |
| Gene alias: | ARP1|COUP-TFII|COUPTFB|MGC117452|SVP40|TFCOUP2 |
| Gene description: | nuclear receptor subfamily 2, group F, member 2 |
| Genbank accession: | NM_021005 |
| Immunogen: | NR2F2 (NP_066285, 283 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQ |
| Protein accession: | NP_066285 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |