| Brand: | Abnova |
| Reference: | H00007026-M10 |
| Product name: | NR2F2 monoclonal antibody (M10), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR2F2. |
| Clone: | 3B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7026 |
| Gene name: | NR2F2 |
| Gene alias: | ARP1|COUP-TFII|COUPTFB|MGC117452|SVP40|TFCOUP2 |
| Gene description: | nuclear receptor subfamily 2, group F, member 2 |
| Genbank accession: | NM_021005 |
| Immunogen: | NR2F2 (NP_066285, 153 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD |
| Protein accession: | NP_066285 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NR2F2 is approximately 10ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |