Brand: | Abnova |
Reference: | H00007026-D01 |
Product name: | NR2F2 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NR2F2 protein. |
Gene id: | 7026 |
Gene name: | NR2F2 |
Gene alias: | ARP1|COUP-TFII|COUPTFB|MGC117452|SVP40|TFCOUP2 |
Gene description: | nuclear receptor subfamily 2, group F, member 2 |
Genbank accession: | NM_021005.2 |
Immunogen: | NR2F2 (NP_066285.1, 1 a.a. ~ 414 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
Protein accession: | NP_066285.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of NR2F2 transfected lysate using anti-NR2F2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NR2F2 MaxPab mouse polyclonal antibody (B01) (H00007026-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |