| Brand: | Abnova |
| Reference: | H00007026-D01 |
| Product name: | NR2F2 MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NR2F2 protein. |
| Gene id: | 7026 |
| Gene name: | NR2F2 |
| Gene alias: | ARP1|COUP-TFII|COUPTFB|MGC117452|SVP40|TFCOUP2 |
| Gene description: | nuclear receptor subfamily 2, group F, member 2 |
| Genbank accession: | NM_021005.2 |
| Immunogen: | NR2F2 (NP_066285.1, 1 a.a. ~ 414 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
| Protein accession: | NP_066285.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of NR2F2 transfected lysate using anti-NR2F2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NR2F2 MaxPab mouse polyclonal antibody (B01) (H00007026-B01). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |