| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007021-M02 |
| Product name: | TFAP2B monoclonal antibody (M02), clone 2F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TFAP2B. |
| Clone: | 2F6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7021 |
| Gene name: | TFAP2B |
| Gene alias: | AP-2B|AP2-B|MGC21381 |
| Gene description: | transcription factor AP-2 beta (activating enhancer binding protein 2 beta) |
| Genbank accession: | NM_003221 |
| Immunogen: | TFAP2B (NP_003212, 73 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL |
| Protein accession: | NP_003212 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TFAP2B expression in transfected 293T cell line by TFAP2B monoclonal antibody (M02), clone 2F6. Lane 1: TFAP2B transfected lysate(50.474 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |