TFAP2A polyclonal antibody (A01) View larger

TFAP2A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFAP2A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TFAP2A polyclonal antibody (A01)

Brand: Abnova
Reference: H00007020-A01
Product name: TFAP2A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TFAP2A.
Gene id: 7020
Gene name: TFAP2A
Gene alias: AP-2|AP-2alpha|AP2TF|BOFS|TFAP2
Gene description: transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Genbank accession: BC017754
Immunogen: TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Protein accession: AAH17754
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TFAP2A polyclonal antibody (A01) now

Add to cart