Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TESK1 monoclonal antibody (M01), clone 1D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about TESK1 monoclonal antibody (M01), clone 1D11
| Brand: | Abnova |
| Reference: | H00007016-M01 |
| Product name: | TESK1 monoclonal antibody (M01), clone 1D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TESK1. |
| Clone: | 1D11 |
| Isotype: | IgG1 kappa |
| Gene id: | 7016 |
| Gene name: | TESK1 |
| Gene alias: | - |
| Gene description: | testis-specific kinase 1 |
| Genbank accession: | BC067130 |
| Immunogen: | TESK1 (AAH67130, 266 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSP |
| Protein accession: | AAH67130 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged TESK1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Tesk1 Interacts with Spry2 to Abrogate Its Inhibition of ERK Phosphorylation Downstream of Receptor Tyrosine Kinase Signaling.Chandramouli S, Yu CY, Yusoff P, Lao DH, Leong HF, Mizuno K, Guy GR. J Biol Chem. 2008 Jan 18;283(3):1679-91. Epub 2007 Nov 1. |