| Brand: | Abnova |
| Reference: | H00007010-M05 |
| Product name: | TEK monoclonal antibody (M05), clone 2D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TEK. |
| Clone: | 2D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7010 |
| Gene name: | TEK |
| Gene alias: | CD202B|TIE-2|TIE2|VMCM|VMCM1 |
| Gene description: | TEK tyrosine kinase, endothelial |
| Genbank accession: | BC035514 |
| Immunogen: | TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND |
| Protein accession: | AAH35514 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TEK monoclonal antibody (M05), clone 2D2 Western Blot analysis of TEK expression in U-2 OS ( Cat # L022V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |