Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TEAD3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TEAD3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007005-A01 |
| Product name: | TEAD3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TEAD3. |
| Gene id: | 7005 |
| Gene name: | TEAD3 |
| Gene alias: | DTEF-1|ETFR-1|TEAD5|TEF-5|TEF5 |
| Gene description: | TEA domain family member 3 |
| Genbank accession: | NM_003214 |
| Immunogen: | TEAD3 (NP_003205, 215 a.a. ~ 302 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD |
| Protein accession: | NP_003205 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Transcription Enhancer Factor 3 (TEF3) Mediates the Expression of Down Syndrome Candidate Region 1 Isoform 1 (DSCR1-1L) in Endothelial Cells.Liu X, Zhao D, Qin L, Li J, Zeng H. J Biol Chem. 2008 Dec 5;283(49):34159-67. Epub 2008 Oct 7. |