No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007005-A01 |
Product name: | TEAD3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TEAD3. |
Gene id: | 7005 |
Gene name: | TEAD3 |
Gene alias: | DTEF-1|ETFR-1|TEAD5|TEF-5|TEF5 |
Gene description: | TEA domain family member 3 |
Genbank accession: | NM_003214 |
Immunogen: | TEAD3 (NP_003205, 215 a.a. ~ 302 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD |
Protein accession: | NP_003205 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.79 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Transcription Enhancer Factor 3 (TEF3) Mediates the Expression of Down Syndrome Candidate Region 1 Isoform 1 (DSCR1-1L) in Endothelial Cells.Liu X, Zhao D, Qin L, Li J, Zeng H. J Biol Chem. 2008 Dec 5;283(49):34159-67. Epub 2008 Oct 7. |