No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Brand: | Abnova |
| Reference: | H00007004-M01 |
| Product name: | TEAD4 monoclonal antibody (M01), clone 5H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TEAD4. |
| Clone: | 5H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7004 |
| Gene name: | TEAD4 |
| Gene alias: | EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B |
| Gene description: | TEA domain family member 4 |
| Genbank accession: | NM_003213 |
| Immunogen: | TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP |
| Protein accession: | NP_003204 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | TEAD4 monoclonal antibody (M01), clone 5H3 Western Blot analysis of TEAD4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Integrative genomics analysis reveals the multilevel dysregulation and oncogenic characteristics of TEAD4 in gastric cancer.Lim B, Park JL, Kim HJ, Park YK, Kim JH, Sohn HA, Noh SM, Song KS, Kim WH, Kim YS, Kim SY Carcinogenesis. 2013 Dec 31. |