Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRDX2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PRDX2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007001-A01 |
| Product name: | PRDX2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PRDX2. |
| Gene id: | 7001 |
| Gene name: | PRDX2 |
| Gene alias: | MGC4104|NKEFB|PRP|PRX2|PRXII|TDPX1|TSA |
| Gene description: | peroxiredoxin 2 |
| Genbank accession: | BC000452 |
| Immunogen: | PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Protein accession: | AAH00452 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women.Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J. Clin Cancer Res. 2009 Jul 15;15(14):4733-41. Epub 2009 Jul 7. |