| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006999-D01P |
| Product name: | TDO2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TDO2 protein. |
| Gene id: | 6999 |
| Gene name: | TDO2 |
| Gene alias: | TDO|TPH2|TRPO |
| Gene description: | tryptophan 2,3-dioxygenase |
| Genbank accession: | NM_005651.1 |
| Immunogen: | TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
| Protein accession: | NP_005642.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TDO2 expression in transfected 293T cell line (H00006999-T03) by TDO2 MaxPab polyclonal antibody. Lane 1: TDO2 transfected lysate(47.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Engagement of the Aryl Hydrocarbon Receptor in Mycobacterium tuberculosis-Infected Macrophages Has Pleiotropic Effects on Innate Immune Signaling.Memari B, Bouttier M, Dimitrov V, Ouellette M, Behr MA, Fritz JH, White JH. J Immunol. 2015 Nov 1;195(9):4479-91. |