| Brand: | Abnova |
| Reference: | H00006999-A01 |
| Product name: | TDO2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TDO2. |
| Gene id: | 6999 |
| Gene name: | TDO2 |
| Gene alias: | TDO|TPH2|TRPO |
| Gene description: | tryptophan 2,3-dioxygenase |
| Genbank accession: | NM_005651 |
| Immunogen: | TDO2 (NP_005642, 307 a.a. ~ 405 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDES |
| Protein accession: | NP_005642 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | n-Butilydenephthalide exhibits protection against neurotoxicity through regulation of tryptophan 2, 3 dioxygenase in spinocerebellar ataxia type 3.Rajamani K, Liu JW, Wu CH, Chiang IT, You DH, Lin SY, Hsieh DK, Lin SZ, Harn HJ, Chiou TW. Neuropharmacology. 2017 May 1;117:434-446. doi: 10.1016/j.neuropharm.2017.02.014. Epub 2017 Feb 20 |