No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006991-A01 |
Product name: | TCTE3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TCTE3. |
Gene id: | 6991 |
Gene name: | TCTE3 |
Gene alias: | MGC142199|TCTEX1D3 |
Gene description: | t-complex-associated-testis-expressed 3 |
Genbank accession: | NM_174910 |
Immunogen: | TCTE3 (NP_777570, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE |
Protein accession: | NP_777570 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TCTE3 polyclonal antibody (A01), Lot # 061103JCS1. Western Blot analysis of TCTE3 expression in Daoy. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |