TCTE3 polyclonal antibody (A01) View larger

TCTE3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCTE3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TCTE3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006991-A01
Product name: TCTE3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TCTE3.
Gene id: 6991
Gene name: TCTE3
Gene alias: MGC142199|TCTEX1D3
Gene description: t-complex-associated-testis-expressed 3
Genbank accession: NM_174910
Immunogen: TCTE3 (NP_777570, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE
Protein accession: NP_777570
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006991-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006991-A01-1-75-1.jpg
Application image note: TCTE3 polyclonal antibody (A01), Lot # 061103JCS1. Western Blot analysis of TCTE3 expression in Daoy.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TCTE3 polyclonal antibody (A01) now

Add to cart