No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006964-M01 |
Product name: | TRD@ monoclonal antibody (M01), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRD@. |
Clone: | 2H6 |
Isotype: | IgG1 Kappa |
Gene id: | 6964 |
Gene name: | TRD@ |
Gene alias: | TCRD|TCRDV1|TRD |
Gene description: | T cell receptor delta locus |
Genbank accession: | X06557 |
Immunogen: | TRD@ (CAA29800, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR |
Protein accession: | CAA29800 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TRD@ monoclonal antibody (M01), clone 2H6 Western Blot analysis of TRD@ expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |