View larger

TRA monoclonal antibody (M03), clone 4H8

Reference:

Condition: New product

Data sheet of TRA monoclonal antibody (M03), clone 4H8

Brand:	Abnova
Reference:	H00006955-M03
Product name:	TRA monoclonal antibody (M03), clone 4H8
Product description:	Mouse monoclonal antibody raised against a partial recombinant TRA.
Clone:	4H8
Isotype:	IgG2a Kappa
Gene id:	6955
Gene name:	TRA
Gene alias:	FLJ22602\|MGC117436\|MGC22624\|MGC23964\|MGC71411\|TCRA\|TCRD\|TRA
Gene description:	T cell receptor alpha locus
Genbank accession:	X01403
Immunogen:	TRA (CAA25651.1, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV
Protein accession:	CAA25651.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged TRA is 1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice